PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_19588-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 119aa    MW: 13619 Da    PI: 4.9404
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_19588-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.92.5e-14556354
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54
                     + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+e  +L  e ee ++
  TRIUR3_19588-P1  5 ATQRQKRMIKNRESAARSRERKQAYIAELEAQVTQLEEEHAELLREQEEQNE 56
                     679*************************************999988776555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.1E-9265IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76557IPR004827Basic-leucine zipper domain
PfamPF001709.4E-13557IPR004827Basic-leucine zipper domain
CDDcd147072.18E-16754No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-13856No hitNo description
SuperFamilySSF579591.5E-11855No hitNo description
PROSITE patternPS0003601025IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MDRAATQRQK RMIKNRESAA RSRERKQAYI AELEAQVTQL EEEHAELLRE QEEQNEKRLN  60
EANAAGFKAG TGAFLYAPVY EVTATTTTEK EEEKERDRAA AWAGGDALPP PPRRRMEED
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBMTransfer from LOC_Os05g36160Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT2243735e-95KT224373.1 Triticum aestivum cultivar RAC875 bZIP2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568373.12e-32PREDICTED: G-box-binding factor 4
TrEMBLM7YJC44e-80M7YJC4_TRIUA; G-box-binding factor 4
STRINGBRADI2G24120.37e-32(Brachypodium distachyon)
STRINGMLOC_53321.16e-33(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.16e-13G-box binding factor 4